PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10037625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 381aa    MW: 42297.7 Da    PI: 6.0829
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10037625genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.13.5e-0713392248
                     T-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 22 gtWktIartmgkgRtlkqcksrwqkyl 48
                     ++W+++++  g+ R++k+c++rw +yl
      Lus10037625 13 KRWSSVPKLAGLQRCGKSCRLRWINYL 39
                     36***********************97 PP

2Myb_DNA-binding49.87.8e-164587145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     rg+++++E  l++++++ lG++ W+ Ia++++ gRt++++k++w+
      Lus10037625 45 RGSFSPQEAALIIELHTILGNR-WAQIAKHLP-GRTDNEVKNFWN 87
                     899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.411139IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.7E-14646IPR009057Homeodomain-like
CDDcd001670.00671739No hitNo description
SuperFamilySSF466892.47E-202596IPR009057Homeodomain-like
PROSITE profilePS5129424.934094IPR017930Myb domain
SMARTSM007174.4E-154492IPR001005SANT/Myb domain
PfamPF002498.4E-144588IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-254795IPR009057Homeodomain-like
CDDcd001676.88E-114787No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRWSSVPK LAGLQRCGKS CRLRWINYLR PDLKRGSFSP QEAALIIELH  60
TILGNRWAQI AKHLPGRTDN EVKNFWNSSI KKKLISHHLH HQFHHGVMIN VPPSGPSGFD  120
PNSASSASSS LLSGGEEAFF SANHHHLLVS PSPSTNNIIN DVSSSSVLQS YGNITISDHH  180
HFNVFDQQYF PNPFLINSSS SASSSSSSLL NIINDPIWPP PPPSFPFLPQ HHHDHQHLLM  240
MNNIDQDHHH HQILITNVNN DDDGDDGAKQ DDHDHQILIT NVNNDDDGDD GAKQDDHDHQ  300
ILIPYNDNDD DDDLLMMPSS PKLSDQAPPK PEDQDHPLSM TSPPPPTSSS QIDDDPYMEA  360
MIMSSLPSPS PAFLGWNMTG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2499424108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8861826e-82HQ886182.1 Linum usitatissimum clone Contig2131 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007024519.16e-63MYB7
TrEMBLA0A061GC446e-63A0A061GC44_THECC; MYB7
STRINGPOPTR_0001s20370.13e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30143168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.22e-52myb domain protein 26